SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003792 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003792
Domain Number 1 Region: 485-826
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.39e-103
Family PDEase 0.00000261
Further Details:      
 
Domain Number 2 Region: 223-326
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000733
Family Heme-binding PAS domain 0.02
Further Details:      
 
Domain Number 3 Region: 98-160
Classification Level Classification E-value
Superfamily CheY-like 0.0000391
Family CheY-related 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003792   Gene: ENSTTRG00000004006   Transcript: ENSTTRT00000004026
Sequence length 830
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3038:4364:119763:1 gene:ENSTTRG00000004006 transcript:ENSTTRT00000004026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAQSIHASESRVAEDAPGPAAPPLQPGGPRLPPGQTTTASARSCGSSLVESESSVGSS
NGSTVAVADIQFGPMRFHPDQLQVLLVFPKEDKQCNGFCRACEKAGFKCTVIKEAQTALA
CFLDKHHDIIIIDHRNPQQLDGEVLCRSIRSSELSENTVIVGVVRXXXXXXXXXXXXXXX
XXXXRYVENPSAMACYNELLQMEFGLVRPQLKLRACNSMFTALEKSQEAIEITSEDHIVQ
YANPAFETTMGYESGELIGKDLAEVPVNEKKADLLDTINSCIRIGKEWQGICSAKEKNGD
NVQQNVKILPVIGQGGKIRHYVSIVRACNGNNKATKIAECVQSDTHTDHQSGKHNDRRKS
SLDVRTAASRTSKVSSQRRRSSTARIHSMKIEAPITKAINIISAAQESSPMPVTEALDRV
LEILRTTELYSPQFDAKDDDPHAIDLVGGLMSDVFRRPSRNEYVLSTKNLQQASSSVITP
TSLHDIPSQITQAMENEESWDFDIFELEAATHKRPLIYLGLKIFARFGVCEVLKCSETTL
RSWLQIIEANYHASNPYHNSTHSADVLHATAYFLCKERIKQTLDPLDEVTALIAATVHDL
DHPGRTNSFLCNAGSELAILYNDTAVLERHHAALAFQLTTGDDKCNIFKNMERNDYRMLR
QSIIDMVLATEMQKHFEHVNKFVNSINKPLAALEEDGEDKNQEAIITMLRTPDNRSLIKR
MLIKCADVSNPCRPLQQCIEWAARISXXXXXXTDEEKRQDLPVVMPVFDRNTCSIPKSQI
SFIDYFITDMFAAWDAFVDLPELMQHLDNNFKYWKGLDEMKLRSLRPPPE
Download sequence
Identical sequences ENSTTRP00000003792 ENSTTRP00000003792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]