SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003796 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003796
Domain Number 1 Region: 452-543,586-672
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.4e-35
Family Protein kinases, catalytic subunit 0.000053
Further Details:      
 
Domain Number 2 Region: 275-400
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-32
Family cAMP-binding domain 0.00096
Further Details:      
 
Domain Number 3 Region: 151-269
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-27
Family cAMP-binding domain 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003796
Domain Number - Region: 29-84
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00523
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003796   Gene: ENSTTRG00000004024   Transcript: ENSTTRT00000004030
Sequence length 762
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2001:58736:143163:-1 gene:ENSTTRG00000004024 transcript:ENSTTRT00000004030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGSVKPKHSKNPDGHSGNLTTSALRSKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPRQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGQLEVFQGEKWLSCIPIWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISEDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSSWKLSKALSLEMIQVKEKGARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYAEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCXXXXXXXXXXLKNGINDIKKHRWLNGFNWEGLK
ARNLPSPLQRELSGPTDHSYFDKYPPEKGVPPDELSGWDKDF
Download sequence
Identical sequences ENSTTRP00000003796 ENSTTRP00000003796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]