SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003887 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003887
Domain Number 1 Region: 8-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.13e-43
Family Dual specificity phosphatase-like 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003887   Gene: ENSTTRG00000004129   Transcript: ENSTTRT00000004129
Sequence length 173
Comment pep:known_by_projection scaffold:turTru1:scaffold_112896:166326:170254:1 gene:ENSTTRG00000004129 transcript:ENSTTRT00000004129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEITYKNMRFLITHNPTNATLNKFIEELKKYGVTTVVRVCEATYDTSLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREDPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Download sequence
Identical sequences ENSTTRP00000003887 ENSTTRP00000003887 XP_019784807.1.83887 XP_019784808.1.83887 XP_019784809.1.83887 XP_019784811.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]