SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004010 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004010
Domain Number 1 Region: 32-65,108-177
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 205-295
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.07e-17
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004010   Gene: ENSTTRG00000004262   Transcript: ENSTTRT00000004260
Sequence length 428
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1030:300354:334635:-1 gene:ENSTTRG00000004262 transcript:ENSTTRT00000004260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRSPRPPPRRCRRRLPRPSCCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSAL
ESPGEAEARARWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAF
YFVGTVVSTIGFGMTTPATVGGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACR
ERQLRRSGLLPATFRRGSALSEADCLAGWKPSVYHVLLILGLFAVLLSCCASAMYTSVEG
WDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGNFLFILLGVCCIYSLFVISIL
IKQVLNWMLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSGELISMRRLKASQQVSLALLQKQLSKTANGYPRSVCVNTRQGFSGGVGALGIMNNS
LAETSASR
Download sequence
Identical sequences ENSTTRP00000004010 ENSTTRP00000004010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]