SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004032 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004032
Domain Number 1 Region: 1450-1621
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-27
Family Fibronectin type III 0.0000101
Further Details:      
 
Domain Number 2 Region: 1894-2061
Classification Level Classification E-value
Superfamily Fibronectin type III 8.78e-27
Family Fibronectin type III 0.00000981
Further Details:      
 
Domain Number 3 Region: 907-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 6.17e-26
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 4 Region: 1634-1788
Classification Level Classification E-value
Superfamily Fibronectin type III 6.41e-23
Family Fibronectin type III 0.0000121
Further Details:      
 
Domain Number 5 Region: 726-890
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 1264-1438
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-21
Family Fibronectin type III 0.0000103
Further Details:      
 
Domain Number 7 Region: 407-462
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-21
Family Fibronectin type II module 0.0000566
Further Details:      
 
Domain Number 8 Region: 1172-1259
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-16
Family Fibronectin type III 0.00000375
Further Details:      
 
Domain Number 9 Region: 1800-1889
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000127
Family Fibronectin type III 0.00000509
Further Details:      
 
Domain Number 10 Region: 349-402
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000857
Family Fibronectin type II module 0.0000825
Further Details:      
 
Domain Number 11 Region: 2328-2371
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000157
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 514-558
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0045
Further Details:      
 
Domain Number 13 Region: 617-699
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000503
Family Fibronectin type III 0.00000543
Further Details:      
 
Domain Number 14 Region: 556-601
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000055
Family Fibronectin type I module 0.0022
Further Details:      
 
Domain Number 15 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000183
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 16 Region: 466-507
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000183
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000288
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 185-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 19 Region: 2283-2326
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000802
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 20 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000209
Family Fibronectin type I module 0.0002
Further Details:      
 
Domain Number 21 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2371-2412
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000144
Family Fibronectin type I module 0.00034
Further Details:      
 
Domain Number 24 Region: 2197-2260
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000077
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 25 Region: 1092-1178
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000967
Family Fibronectin type III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004032   Gene: ENSTTRG00000004280   Transcript: ENSTTRT00000004286
Sequence length 2465
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1729:353962:424088:-1 gene:ENSTTRG00000004280 transcript:ENSTTRT00000004286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGDPGPRLLLLLTVLFLGTAVPSTGASKSKRQAQQVVQPQSPLAVSQSKPGCYDNGKHY
QINQQWERTYLGSALICTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWRKKDNRGNLLQCICTGNGRGEWKCERHTTLQTTSAGSGSFTDVRTAIYQPQPH
PQPAPYGHCVTDSGVVYSVGMQWLKAQGNKQMLCTCLGNGVSCQETAITQTYGGNSNGEP
CVPFYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCH
FPFLYNNQNYTDCTSEGRRDNMKWCGTTRNYDADQKFGFCPMAAHEEICTTNEGIMYRIG
DQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGHML
NCTCFGQGRGRWKCDPIDQCQDSESRTFYQIGESWEKFLHGVRYQCYCYGRGIGEWGCQP
IQTYPGSTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNSPDRWKEATIPG
HLNSYTIKGLRPGVVYEGQLISVQHYGQREMTRFDFTTTSTSPVVTXXXXXXXXXXXSPV
VATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL
PGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGV
PRSDKVPPPRDLQFVEVTDVKITIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPTSRNTF
AEVTGLSPGVTYHFKVFAVNHGRESKPLTAQQATKLDAPTNLQFINETDTTIIVTWTPPR
ARIAGYRLTVGLTRGGQPKQYNVGPSSTQYPLRNLQPGSEYSATLVAVKGSQQSPRATGV
FTTLQPLGSIPPYHTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIVVS
GLTPGVEYIYTISVLKDGQERDTPIVKKVVTPLSPPKNLHLETNPDTGVLTVSWERSSTP
DITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPISD
TIMPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVG
YYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWAPP
PSIELTNLLVRYSPVKNEEDVAELSVSPSDNAVFLTNLLPGTEYLVSVSSVYEQHESVPL
RGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYKIRHHPEHMNGRPREDRVPPSR
NSITLTNLNPGTDYVVSIVALNGKEESPSLVGQQTTVSDVPRDLEVIAATPTSLLISWDA
PAVTVRYYRITYGETGGSSPVQEFTVPGSKSTATISGLKPGADYTITVYAVTGRGDSPAS
SKPISIDYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPKNGPDQTEMTIE
GLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVS
RYRVTYSSPEDGIHELFPAPDGEEETAELQGLRPGSEYTVSVVALHDDMESQPLIGTQST
AIPAPTNLKFTQVSPTSLAAQWTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVS
GLMVTKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETI
TGFQVDAIPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVVIDAST
AIDAPSNLHFLATTPNSLLLSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT
GLEPGIEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTP
FITNPGYDTGNGIQLPGTSGQQPSLGQQMIFEEHGFRRTTPPTMASPVRHRPRPYPPNVN
EEIQIGPVPRGDVDHHLYPHVLGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPVGI
DEEPLQFRVPGTSASATLTGLTRGATYNIIVEAIKDQKRHKVREQVVTVGNSVDQGLNQP
TDDSCFDPYTVSHYAIGEEWERLSESGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIG
EKWDRQGESGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTC
FGGQRGWRCDNCRRPGAEPGHEGSTGHSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
EDSRE
Download sequence
Identical sequences ENSTTRP00000004032 ENSTTRP00000004032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]