SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004039 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004039
Domain Number 1 Region: 185-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-59
Family Voltage-gated potassium channels 0.0007
Further Details:      
 
Domain Number 2 Region: 31-140
Classification Level Classification E-value
Superfamily POZ domain 1.41e-31
Family Tetramerization domain of potassium channels 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004039   Gene: ENSTTRG00000004295   Transcript: ENSTTRT00000004294
Sequence length 858
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1130:704020:804423:-1 gene:ENSTTRG00000004295 transcript:ENSTTRT00000004294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKL
RDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELD
YWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLE
KPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQTTDNPQLAHVEAVCIAWF
TMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFR
IMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTK
FKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFY
KEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFPRSIEVMDIVVEKSGENMGQKDKVQD
NHLSPNKWKWTKRTLSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLEDMYNKMAKTQ
SQPILNTKEPATQSKPKEELEMESIPSPVAPLPTRTEGVIDMRSMSSIDSFISCATDFPE
ATRFSHSPLASLPSKTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPLVPVLGMYHDPLSNRGGAAAAVAGLECATLLDRPVLS
PESSIYTTASARTPPRSPEKHTAIAFNFEAGIHQYIDADTDDEGQVLYSVDSSPPKSLHG
NTSPKFSVGTRSEKNHFESSPLPTSPKFLRQNCIYSTEALTGKTPSGQEKCKLENHISPD
VRVLPGGGAHGSTRDQSI
Download sequence
Identical sequences ENSTTRP00000004039 ENSTTRP00000004039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]