SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004106 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004106
Domain Number 1 Region: 1276-1414
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.04e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000016
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004106
Domain Number - Region: 232-288
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0474
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004106   Gene: ENSTTRG00000004349   Transcript: ENSTTRT00000004362
Sequence length 1420
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_989:7869:84772:1 gene:ENSTTRG00000004349 transcript:ENSTTRT00000004362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVPEELREPFYTDQYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQAL
AQKGLYVTDQEKLVTERDLHKKPIQMSAHLAMMDTLMMAYTVEMVSVEKVAACAQQYSAF
FQATDLPYDIEDAVMYWINKVNEHLKDIMEQTQKLKDHHTVEASGGQKSPSKWFWKLVPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICLKETMSLADSL
YNLQLIQEFCQEYLNQCCHFALEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRDA
RPQGAEPVDDLPSDPVLTAAQRNALDSSDFTPSGEGAALTHSRPHLPSRHSRPQAHPSAS
GGIRRSSSMSYVDGFIGTWPKEKRSSVHGVSFDISFDKESSIQRSTPNQGITRSISNEGL
TLNNSRVSKNIRKNLSFKPVNGEEGAGSIEEELQVGSHGHLTAYVPLNTNEVGSKQNMAH
RLPNGALQSRVLLDEFGSQVGTPSIEEALQIIHDTEQPAHTPRPDQLANGFFLHSQDMGV
LNCSVPRSQSSPESMADTKGASSPVTDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLD
SDVDDTSKFLQDYNPREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDG
KSSGSSSQKTTPEGSELNIPHVVAWAQTPEDTGLPHGRDTTQLLASEVVHLRMKLEEKRR
AIEAQKKKMDAAFTKQRQKMGRTGFLVERKGDGPSPPREEAXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWSPACPAEEPPQDGELLEHTRSI
ERLNASLLVLQREMQRLALQQELLMHMREQQAWVISPPPPSPHRPAQGSPPAAAEAPRPA
HPSPQPAARKSASFSVKTQRTPRPNELKLTPLHRTLTPPRSVDSLPRLRRFSPSQVPIQT
RSFVCLGGGGEPEAKESGRKEGAEDEEGEEEGEGSTGPREQHGHIPEDEEAQAPPPAAPE
GLARPARSEDRVSQPAEPPCRPAFPPAAPKSANLIEVSLSDLKAPEKADVSVEKYDGESD
KEPVDDDQKVCCGFFFKXDQKAENDMSMKRAALVEKRLRREKETQLRKQQLEAEMEHKKE
ETRRKTEEERQKKEDERARREFIRQEYLRRKQLKLMEDMDTVIKPRPQGAKQKKQRPKSI
HRDHIESPKTPIKGPPVSSLSLASLNTGDSESVHSGRRTPRSESVEGFLSPSRCGSRNGE
KDWENASTTSSVASGTEYTGPKLFKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEE
MEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRK
QFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences ENSTTRP00000004106 ENSTTRP00000004106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]