SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004155 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004155
Domain Number 1 Region: 6-97
Classification Level Classification E-value
Superfamily DNA-binding domain 3.6e-28
Family Methyl-CpG-binding domain, MBD 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004155   Gene: ENSTTRG00000004412   Transcript: ENSTTRT00000004411
Sequence length 289
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_652:46970:57504:-1 gene:ENSTTRG00000004412 transcript:ENSTTRT00000004411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLS
TFDFRTGKMLMGKMNKSRQRVRYDSPSQVKGKPDLNTALPVRQTASIFKQPVTKITNHPS
NKVKSDPQKAVEQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSA
IASALHTSTMPITGQLSAAVEKNPGVWLNTAQPLCKAFMVTDEDIRRQEELVQQVRKRLE
EALMADMLAHVEELARDGEAPLGRAGADGDEDDGDQEEGPDQDQEMEHV
Download sequence
Identical sequences ENSTTRP00000004155 XP_004286384.1.21590 ENSTTRP00000004155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]