SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004176 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004176
Domain Number 1 Region: 172-412
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.87e-39
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 18-126
Classification Level Classification E-value
Superfamily POZ domain 3.4e-24
Family Tetramerization domain of potassium channels 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004176   Gene: ENSTTRG00000004439   Transcript: ENSTTRT00000004433
Sequence length 474
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2929:7898:25506:1 gene:ENSTTRG00000004439 transcript:ENSTTRT00000004433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWPCSPGGVGGARARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDELLRVCD
DYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGACALAFRDELAYWGIDEARLERCCL
RRLRRREEEAAEARAGPAERGGPGSPACAPGSRGRLARGRRRLRDVLDDPRSGPAGKLFA
CVSVAFVAVTAVGLCLSTMPDIRAEEERXXXXXXXXXXXXXXXXXXXXXXXXXLLRSLQA
ESKCAFLRTPLNIIDILAILPFYVSLLVGLAARPGAGGNKLLERAGLVLRLLRALRVLYV
MRLARHSLGLRSLGLTVRRCAREFGLLLLFLCVAMALFAPLVHLAERELGARRDFSSVPA
SYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKQQ
QQRAASPEPALREDSTHSASACASAAEDDNSQGPDGAGPTGDSAAALWASAGPP
Download sequence
Identical sequences ENSTTRP00000004176 ENSTTRP00000004176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]