SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004317 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004317
Domain Number 1 Region: 1-349
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.62e-68
Family ADP-ribosylglycohydrolase 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004317   Gene: ENSTTRG00000004577   Transcript: ENSTTRT00000004583
Sequence length 353
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2022:15226:25659:-1 gene:ENSTTRG00000004577 transcript:ENSTTRT00000004583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFQAAMLLGAVGDALGHGHAFGEDSASGPKVQKEPGKVGGLDHLVLSPERWPVSDNTI
MHMATAGALVTDFWCLDDLYREMVRRYVDVLEKLPGQRVDPATVEGCSQLKPDNYLLAWH
TPFNEKGSGFGAATKAMCVGMRYWQPGRLETLLEVSVECGRMTHNHPTXXXGSLCTALFA
SYAIQGKRLEQWGRDMLRTVPLAEEYCKRTIRHLAEYQEHWFYFEAKWQFYLEERKISED
TENEASFPDRYSAEERDKDYRKSSSERSRCRRGHDAPMIYDAILGAKDSWTELCHRAMFH
GGESGATGAIAGCLFGLLHGLDAVPAGLYRELELKEQLRRLGEELYRLSAEEK
Download sequence
Identical sequences ENSTTRP00000004317 ENSTTRP00000004317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]