SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004325 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004325
Domain Number 1 Region: 226-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-51
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 22-131
Classification Level Classification E-value
Superfamily POZ domain 4.45e-31
Family Tetramerization domain of potassium channels 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004325   Gene: ENSTTRG00000004613   Transcript: ENSTTRT00000004591
Sequence length 898
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3612:141798:203510:1 gene:ENSTTRG00000004613 transcript:ENSTTRT00000004591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESL
LEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYL
ESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAK
XXXXXXXXXXXXXXXXXXXXXXXXXXXMDEFGQPNDNPQLAHVEAVCIAWTMEYLLRFLS
SPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRILKL
ARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWW
ATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAI
KRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKTGESANTKDSTGDNRLSPSRWKW
ARKALSETSSNKSYENKYQEVSQKDSHEQLNNTSSSSPQHLSAQKLEMLYNEITKTQPHS
HPNPERQQQPERPSAYEEEIEMEEVICPQEQLAVAQAEGIVDMKSTSSIDSFTSCATDFT
ETERSPLPPPSACHPQMKFPPDLARIEEHQRARAPPFLTLTREKMPAARDASPEYAPIDV
TVNLDSSGSQGGPHGPSQSDSAAESPRSSLKGSNPLKSGSLKVNFKDNRGGAPQTPPSTA
RPLPVTAADFPLTTPQLISTILLEETPSQGDRPLLGAEVPAHCQGPSKGLTPRFPKQKLF
PFSSRERRSFTEIDTGEDDDFLELQGTTRQDKQADSNPNCFADKPSDGRDPLREEASVGA
SSPQDTSHNCRQDIYHAVAEVKKDTSQEGCKMENHLFAPEIHSNPGDTGYCPTRETSM
Download sequence
Identical sequences ENSTTRP00000004325 ENSTTRP00000004325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]