SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004333 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004333
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.55e-72
Family Alanine racemase-like, N-terminal domain 0.000000000687
Further Details:      
 
Domain Number 2 Region: 267-413
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 8.16e-49
Family Eukaryotic ODC-like 0.000000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004333   Gene: ENSTTRG00000004611   Transcript: ENSTTRT00000004599
Sequence length 460
Comment pep:known_by_projection scaffold:turTru1:scaffold_89736:38972:43100:-1 gene:ENSTTRG00000004611 transcript:ENSTTRT00000004599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFSNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWFKALP
RVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELEIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKRVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPTXXXXXXX
XXXXXXXXXXEQDIGTLPVSCAWESGMKRHPACASARINV
Download sequence
Identical sequences ENSTTRP00000004333 ENSTTRP00000004333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]