SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004404 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004404
Domain Number 1 Region: 37-149
Classification Level Classification E-value
Superfamily FKBP-like 9.23e-37
Family FKBP immunophilin/proline isomerase 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004404   Gene: ENSTTRG00000004690   Transcript: ENSTTRT00000004673
Sequence length 203
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2810:89618:93230:-1 gene:ENSTTRG00000004690 transcript:ENSTTRT00000004673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSLLPLRVLLLLPLLLSGAVCRADAGFETESPVRTLQVETLVEPPEPCAEPAAFGD
TLHIHYSGSLVDGRIFDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRVIVPSHLA
YGKRGFPPSIPADAELHFDVELIALIRANYWQKLVKGILPLVGMAMVPTLLGLIGYHLYK
KASRPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences ENSTTRP00000004404 ENSTTRP00000004404 XP_004274429.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]