SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004457 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004457
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 2.09e-22
Family LEM domain 0.0000612
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000004457
Domain Number - Region: 136-155
Classification Level Classification E-value
Superfamily LEM domain 0.0216
Family LEM domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004457   Gene: ENSTTRG00000004734   Transcript: ENSTTRT00000004729
Sequence length 693
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1059:46841:58448:1 gene:ENSTTRG00000004734 transcript:ENSTTRT00000004729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKEKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSK
GPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXTTRKLYEKKLLKLREQGTESRSSTPLPAISSSVENTRQNGSNDS
DRYSDNEEGKKKEHKKVKSTRDFFPFSELPTTPSGGFFQGISFPEISTRPPLGRTEQQAA
KKVHSSKGDPPREPLIATALPGREQMQKLASGGNLFVSSKSSHDRCLEKSSSTSPQHELA
AMLVSAAASPSLIKETTSTCYKDIVENIYCGEKSGIQPLCTERSHVSDQSVLSSERRALE
ESERSQVISPPLAKAIRDYVSSLLVQGGVGSLPGTSSSTPPLDVENIWKRIDAPNFRETE
SLSPPRKLPRLSEKSVEEKDSGSSVAFQNIPGSELMSSSAKTVVSHSLTTLGIEMSKQSQ
HDKIDAPELSFPFHESILKVIEEEWQQIGRQLPSLACKYPISSREATRILSVPEVDDEIL
GFISEATPPAGIQAASPESCDKQLDLALCGTYEAAASALQIATHTAFVVRAMQADISQAA
QILSSDPSHVHQALGMLSKTYDAASFLCEAAFDEIKMAAYTMGSSTLGRRYLWLKDCKIN
PASKNKLAVTPFKGGTLFGREVFKVIKKSGKKH
Download sequence
Identical sequences ENSTTRP00000004457 ENSTTRP00000004457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]