SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004474 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004474
Domain Number 1 Region: 11-204
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 6.54e-43
Family Isochorismatase-like hydrolases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004474   Gene: ENSTTRG00000004746   Transcript: ENSTTRT00000004747
Sequence length 218
Comment pep:known_by_projection scaffold:turTru1:scaffold_85075:6716:9581:1 gene:ENSTTRG00000004746 transcript:ENSTTRT00000004747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVRPGLGRIIPGSSILFLCDMQEKFRHVSFFPQIVSVAARMLKVAQLLDVPVVLTEQY
PQGLGPTVPELGAEGLQPWSKTCFSMVPAVQQELDARPQLRSVLLCGLETQACILDPFSC
LGVALTSFPHTALDLLDQGLQVHVVVDACTSRSQVDRLVALSRMRQSGAFLSTSEGLILQ
LVGDATHPRFKEIQKIIKEPAPDSGLLGLFHGQNPLFR
Download sequence
Identical sequences ENSTTRP00000004474 ENSTTRP00000004474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]