SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004503 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004503
Domain Number 1 Region: 40-194
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 9.94e-80
Family Hedgehog (development protein), N-terminal signaling domain 0.000000241
Further Details:      
 
Domain Number 2 Region: 199-345
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.08e-36
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004503   Gene: ENSTTRG00000004783   Transcript: ENSTTRT00000004778
Sequence length 396
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2810:236890:241112:-1 gene:ENSTTRG00000004783 transcript:ENSTTRT00000004778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPASLVPLCCLALLALPAQSCGPGRGPVGRRRYVRKQLVPLLYKQFVPSVPERTLGAS
GPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTPVL
LFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPEPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRFLYRLAEELLD
Download sequence
Identical sequences XP_007107599.1.24612 XP_007179853.1.59432 XP_007452316.1.90284 ENSTTRP00000004503 ENSTTRP00000004503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]