SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004855 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004855
Domain Number 1 Region: 21-277
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.14e-88
Family Carbonic anhydrase 0.00000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004855   Gene: ENSTTRG00000005147   Transcript: ENSTTRT00000005149
Sequence length 314
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1448:205959:211417:1 gene:ENSTTRG00000005147 transcript:ENSTTRT00000005149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFMLLLEVIWTLAANGGQHWTYDGPHGQEHWPASYECEATTQSPINIQTGSVTFDPEL
LPLQPHGYEEPGTEPLDLHNNGHTVQLSLPPTLYLEGLPRKYVAAQLHLHWGQKGSLGGS
EHQINGEATAAELHIVHYDSDSYESLSEAAQRPQGLAVLGILIEVGETKNPAYEHILSHL
HEIRHKDQKTSVPPFNLRELFPPLLAQYFRYNGSLTTPPCYQSVLWTVFSRRAQISIGQL
EKLQETLFSTEEEPSKLLVQNYRAPQPLNQRTVFASFIQVGSLYTTGEMLSLGVGILVGC
LCLLLAVYFIARKI
Download sequence
Identical sequences ENSTTRP00000004855 ENSTTRP00000004855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]