SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004866 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004866
Domain Number 1 Region: 37-269,335-473
Classification Level Classification E-value
Superfamily ALDH-like 2.17e-108
Family ALDH-like 0.000000000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004866   Gene: ENSTTRG00000005093   Transcript: ENSTTRT00000005160
Sequence length 478
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3098:41714:68780:1 gene:ENSTTRG00000005093 transcript:ENSTTRT00000005160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWNESKSGKKFATYNPSTLEKICEVEEGDKLDVDKAVEAAQAAFQRGSPWRRLDA
LSRGRLLHQLADLMERDRAVLATLETMDTGKPFLHAFFIDLEGCIKTLRYFAGWADKIQG
RTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTVVVKPAEQTPLTA
LYLGSLIKEVGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASHSN
LKRVTLELGGKNPCIVCADADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXIDQKQFNKILDLIESGKEGAKLEYGGSAMEDRGLFIK
PTVFSXXXXXXXXXXXXIFGPVQPILKFKNIEEVIKRANSLEYGLTAAVFTKNLDKALKL
ASALESGTVWINCYNAIYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLDDKDP
Download sequence
Identical sequences ENSTTRP00000004866 ENSTTRP00000004866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]