SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004943 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004943
Domain Number 1 Region: 150-245,280-354
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.41e-23
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004943   Gene: ENSTTRG00000005244   Transcript: ENSTTRT00000005241
Sequence length 417
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_381:121009:123962:-1 gene:ENSTTRG00000005244 transcript:ENSTTRT00000005241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRAPELYRAPFPLYALQVDPSAGLLIAAGGGGAAKTGIKNGVHFLQLEQINGRLSAS
LLHSHDTETRATMNLALAGNILAAGQDAHCQLLRFQIHQQKSKNKAGKAGSKEQGPRQRK
GAAPAEKSGAETHQEEIEFSVENLQAVQTDFSTDPLQKVVCFNHDSTLLATGGTDGYVRV
WKVPTLEKVLEFRAHEGEIEDLALGPDGKLVTVGWDLKASVWQKDQLVTQLHWQENGPTF
SNTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSTFLPLRTKSCGH
EVISCLSVSESGTFLGLGTVTGSVAIYIAFSLQRLYYMKEAHGIVVTDVAFLPEKGRGPE
LLGSQETALFSVAVDSRCQLHLLPSRRSVPIWLLLLLCVGLIVVTILLLQRAFPAFL
Download sequence
Identical sequences ENSTTRP00000004943 ENSTTRP00000004943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]