SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004968 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004968
Domain Number 1 Region: 274-356
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-16
Family Voltage-gated potassium channels 0.0051
Further Details:      
 
Domain Number 2 Region: 15-49,96-161
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.98e-16
Family Voltage-gated potassium channels 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004968   Gene: ENSTTRG00000005273   Transcript: ENSTTRT00000005270
Sequence length 377
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3185:102549:113494:1 gene:ENSTTRG00000005273 transcript:ENSTTRT00000005270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAGPPQDRRCCWEALRKIFPRLCFHCSLVTYALVGAALFSAIEGSQDLGADDPEFEEF
LEKLCDILKCNRTVEEGRKRGLGKLLQKVKPQWFSGSADRSFLSSLFFCCTVGKSRGYGN
ACPVTRLGKHLCVLCALFGVPLMFLVLSDTGDILATILSMSYHQFQKLLSPSPLPKWRSG
PSCERRPDVNPVDEAIPRIAINDPELPGPKPAPSIPSSNMELFERLLAREKGNTRQVPPQ
AMEGSSSRPELVFGRLSYSIINNLDEAGRQEERLGIPLPIIALVVVAYVSCAAAILPIEK
QLNFENAFCFCFVTLTTVGFGDIAFEQPHFLFFSIYIIVGMEIVCMAFKLVQNRLIHIYR
NVVLFFANGKCYNPVKK
Download sequence
Identical sequences ENSTTRP00000004968 ENSTTRP00000004968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]