SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005045 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005045
Domain Number 1 Region: 138-309
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.12e-50
Family NadC C-terminal domain-like 0.0000298
Further Details:      
 
Domain Number 2 Region: 33-137
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.18e-24
Family NadC N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005045   Gene: ENSTTRG00000005369   Transcript: ENSTTRT00000005353
Sequence length 322
Comment pep:novel genescaffold:turTru1:GeneScaffold_3331:15277:25833:1 gene:ENSTTRG00000005369 transcript:ENSTTRT00000005353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPLPQSPASLTTELWAHQSQLQAVMDPEGLALLLPPATLAALAESWLREDCPGLNHMALV
TGAASSQAVLWAKSPGVLAGRPFFDAIFAQVNCQVSWFLPEGSKLVPVAKVAEVRGPVHY
LLLGERVALNMLARCSGVASAAAAAVETARGTGWAGHVAGTRKTTPGFRLVEKYGLLVGG
AASHRYDLGGLVMVKDNHIVAAGGVEKAVRGARQAADFSLKVEVECSSLQEAVDAAEAGA
DLVLLDNFRPEELHPTAAALKARFPNVGVEASGGITLDSLPQFCGPHIDVISLGMLTQAA
PALDFSLKLFAEGATPVPYARR
Download sequence
Identical sequences ENSTTRP00000005045 ENSTTRP00000005045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]