SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005060 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005060
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.16e-73
Family Eukaryotic type heme oxygenase 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005060   Gene: ENSTTRG00000005378   Transcript: ENSTTRT00000005368
Sequence length 316
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_603:63045:67301:1 gene:ENSTTRG00000005378 transcript:ENSTTRT00000005368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAELETSEGVDEPEKKSSGAPEKENHTRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIRKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPSELHRKAALIKDMEYFYGED
WEEQVQCSEATRKYVERIHCVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQFYRARMNALDLNLKTKEKIVEEANKAFEYNMQIFSELDQA
GSLLAKETLEDGLPVHDGKGDVRKCPYYAAKQDKGALEGSSCPFRTVLAVLSKPSLQFIL
AASVALAAGLLAWYYM
Download sequence
Identical sequences XP_004310399.1.83887 XP_019784402.1.83887 XP_019784403.1.83887 XP_019784404.1.83887 XP_019784405.1.83887 XP_019784407.1.83887 XP_019784408.1.83887 XP_019784409.1.83887 ENSTTRP00000005060 ENSTTRP00000005060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]