SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005323 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005323
Domain Number 1 Region: 215-642,675-751
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.59e-195
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.88e-69
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005323   Gene: ENSTTRG00000005640   Transcript: ENSTTRT00000005640
Sequence length 791
Comment pep:known_by_projection scaffold:turTru1:scaffold_108809:143120:178457:1 gene:ENSTTRG00000005640 transcript:ENSTTRT00000005640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLFNYINPHNGKHSPMVAKST
VDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKISGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYESYEKEGRFRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFMKLAEVTKVIVRNLNKI
IDINYYPVPEASVSNRCHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGAL
EASCELAKEYGPYETYEGSPVSKGILQYDMWNVTPTNLWDWKLLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQII
ACNGSIQSIPEIPEDLKQLYKTVWEISQKTILKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEKERNTAAMVCSL
ENRDECLMCGS
Download sequence
Identical sequences ENSTTRP00000005323 XP_019795074.1.83887 ENSTTRP00000005323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]