SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005484 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005484
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.5e-101
Family Carbonic anhydrase 0.00000000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005484   Gene: ENSTTRG00000005813   Transcript: ENSTTRT00000005803
Sequence length 260
Comment pep:known_by_projection scaffold:turTru1:scaffold_105903:118124:131769:1 gene:ENSTTRG00000005813 transcript:ENSTTRT00000005803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHWGYGKHNGPEQWHKDFPIANGERQSPVDIHTQAAVHDPTLKPLSLRYEQATSRRII
NNGHSFNVEFDDSQDKAVLEGGPLTGTYRLIQFHFHWGSSDEQGSEHTVDKKKYAAELHL
VHWNTKYGEFGKAAQQPDGLAVLGIFLKIGDAKPGLQKVVDVLDSIKAKGKSAEFTNFDP
RGLLPESLDYWTYPGSLTTPPLLESVTWLVLKEPISVSSEQLSKFCTLNFNAEGEPEHLM
VNNWRPTQPLKNRQIKASFK
Download sequence
Identical sequences ENSTTRP00000005484 XP_004324981.1.83887 ENSTTRP00000005484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]