SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005694 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005694
Domain Number 1 Region: 672-859
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 402-577,607-668
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-43
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 3 Region: 38-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-20
Family Flavin-binding PAS domain 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005694   Gene: ENSTTRG00000006020   Transcript: ENSTTRT00000006022
Sequence length 1198
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_903:28736:435850:-1 gene:ENSTTRG00000006020 transcript:ENSTTRT00000006022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDEENSASPERLNTILPVKTVNXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGFSVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDVKTEKKNTSPPSSDKTIIA
PKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLLQSQSMNDSEGDNCKLRRRRLSFDS
EGEKGSTTNDPEDSVDTIRHYQRSKKHFEEKKSRSSSFISSIDDEQKPLFSGIVDSPPGI
GKVTGLDLEETVPTSGRIPIDKRSHSCKDIADTRSWERETAGTQADESSPSALPRAAWGI
SETESDLAYGEVEQRLDLLQEQLNRLESQMTADVQTILQLLQKQTTVVPPAYSMVTTGTE
YQRPVIHLMRTSHPVASIKTDRSFSPSSQCPEFLDLEKSKLKSKEPLSSGVHLNTASEDN
LTSLLKQDSDLSLELHPPRQRKTCLHPIRHPSLTDSSLSTVGILGLHRHVSDPGLPGK
Download sequence
Identical sequences ENSTTRP00000005694 ENSTTRP00000005694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]