SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005793 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005793
Domain Number 1 Region: 4-229
Classification Level Classification E-value
Superfamily Flavoproteins 3.03e-67
Family Quinone reductase 0.00000000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005793   Gene: ENSTTRG00000006128   Transcript: ENSTTRT00000006125
Sequence length 231
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1143:24806:39306:1 gene:ENSTTRG00000006128 transcript:ENSTTRT00000006125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKKVLIVYAHQEPRSFNGSLKDVAVAELSRQGCTVTVSDLYAMDFEPRATRKDITGAL
SRPEFFSYGVEAYEACKKGSLTSDIIAEQKKVQEADLVMFQFPLYWFSVPAVLKGWMDRV
LCQGFAFDIPGFYDDGLLKGKLAILSITTGGTADMYWKTGANGDFRYFLWPLQHGTLHFC
GFKVLAPHISFAPEYASEEERKGMVASWAQRLKTIWNEEPIPCSPPWYFGQ
Download sequence
Identical sequences ENSTTRP00000005793 ENSTTRP00000005793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]