SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005916 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005916
Domain Number 1 Region: 194-393
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.24e-61
Family Mevalonate 5-diphosphate decarboxylase 0.0000339
Further Details:      
 
Domain Number 2 Region: 10-193
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.07e-29
Family GHMP Kinase, N-terminal domain 0.00000959
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005916   Gene: ENSTTRG00000006259   Transcript: ENSTTRT00000006253
Sequence length 400
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2153:100416:106239:-1 gene:ENSTTRG00000006259 transcript:ENSTTRT00000006253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXRRLARKRRSDGHEEPLPLSLSYKVHVASVNNFPT
AAGLASSAAGYACLAYALARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGERADGKD
SIARQVAPESHWPELRVLILVVSTEKKPTGSTAGMQTSVETSALLRFRAEALVPARMAEM
THCVRERDFQAFGQLTMKDSNQFHATCMDTFPPISYLNDTSRRIIQLAHCFNAHHGQTKV
AYTFDAGANAVIFTLDDTVAEFVAAVRHSFPPELNGDKFLKGLPVEPVPLSDELKAALGT
DPTPGGIKYIIATQVGPGPQVLDDPGAHLLGPDGLPKAAA
Download sequence
Identical sequences ENSTTRP00000005916 ENSTTRP00000005916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]