SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005917 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005917
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.62e-40
Family Band 7/SPFH domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005917
Domain Number - Region: 208-325
Classification Level Classification E-value
Superfamily ALDH-like 0.0209
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005917   Gene: ENSTTRG00000006257   Transcript: ENSTTRT00000006254
Sequence length 356
Comment pep:known_by_projection scaffold:turTru1:scaffold_114966:59850:62923:-1 gene:ENSTTRG00000006257 transcript:ENSTTRT00000006254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARSVRASGALLLRGSVQASGRAARRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPVPGAQDSVSSRSSRDVQSTDASLDEELDRVKLS
Download sequence
Identical sequences ENSTTRP00000005917 ENSTTRP00000005917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]