SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006069 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006069
Domain Number 1 Region: 88-279
Classification Level Classification E-value
Superfamily Cytochrome c 5.21e-74
Family Cytochrome bc1 domain 0.00000000762
Further Details:      
 
Domain Number 2 Region: 280-325
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 5.23e-16
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006069   Gene: ENSTTRG00000006413   Transcript: ENSTTRT00000006413
Sequence length 325
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3351:17945:20127:1 gene:ENSTTRG00000006413 transcript:ENSTTRT00000006413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVASLPELGLGPRGAGLPGARRGLLSGARSGQLPLRTPQAVSLSSKSGPSRGRKVI
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVEDGPNENGEMFMRPGKLSDYFPKPYP
NPEAARAANNGALPPDLSYVVRARHGGEDYVFSLLTGYCEPPTGVSLREGLHFNPYFPGQ
AIGMAPPIYNEVLEFDDGTPATMSQVAKDVSTFLRWTSEPEHDHRKRMGLKMLMMMGLLL
PLVYAMKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences ENSTTRP00000006069 ENSTTRP00000006069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]