SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006259 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006259
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily UBC-like 2.82e-18
Family RWD domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006259   Gene: ENSTTRG00000006616   Transcript: ENSTTRT00000006615
Sequence length 172
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3027:54006:70198:-1 gene:ENSTTRG00000006616 transcript:ENSTTRT00000006615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPP
IISMNAFFNNTISSAVKQSILAKLQEAVEVNLGTAMTYTXFKNNDASISNIISVETPNTA
PSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDDE
Download sequence
Identical sequences ENSTTRP00000006259 ENSTTRP00000006259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]