SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006266 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006266
Domain Number 1 Region: 28-249
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.07e-30
Family FAD-linked reductases, N-terminal domain 0.062
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006266
Domain Number - Region: 567-616
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0651
Family Transferrin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006266   Gene: ENSTTRG00000006622   Transcript: ENSTTRT00000006621
Sequence length 680
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_498:104586:117809:-1 gene:ENSTTRG00000006622 transcript:ENSTTRT00000006621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSAAALLWGLPGLLLTIALHPALSVPAHRDYCVLGAGPAGLQMAYFLQRAGRDYAVFE
RAPRPGSFFTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSNAYFP
DAGDMVRYLGDFADRLGLHVLYNTTIAHVTLNKDQRAWNGHYFILTDQKGQAYQCSVLLV
ATGLSVPNQVDFPGSEYLDGYESVSVDPEDFVGQNVLILGRGNSAFETAENILGVTNFIH
MLSRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLESDLTDLAIVKDLEGKFHVTL
KFLLEEGNRSADAVPLPQDDNDNFALRVGYDRVIRCLGWNFDFSIFSKSLRLSAGGELSK
KYPLVKASYESKGSRGLFVLGTASHSVDYRKSAGGFIHGFRYTXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNATXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXYGRNFSGPDKDVFFYDRSVGHTEDAWLSNFLHPVIYYYRHLPTE
QEVRFRPAGWPLPRPTAIHHIVEDFLTDWTAPVGHILPLRRFLENCLDTDLRSFYAESCF
LFALTRQKLPPFCQQGYLRTQGLVGTESLRQHGVESGLLWDYATVGRGVSGQQPGDHGPG
QHPLAPGPPVSPFDSNKEEL
Download sequence
Identical sequences ENSTTRP00000006266 ENSTTRP00000006266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]