SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006304 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006304
Domain Number 1 Region: 86-223
Classification Level Classification E-value
Superfamily FKBP-like 1.53e-37
Family FKBP immunophilin/proline isomerase 0.000000954
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006304
Domain Number - Region: 25-88
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00273
Family Mevalonate 5-diphosphate decarboxylase 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006304   Gene: ENSTTRG00000006664   Transcript: ENSTTRT00000006661
Sequence length 224
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2958:211506:225435:-1 gene:ENSTTRG00000006664 transcript:ENSTTRT00000006661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFESKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETVDEGPPKYTKSVLKKGD
KTNFPKKGDIVHCWYTGTLQDGTVFDTNIQTSSKKKKNAKPLSFKVGIGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
Download sequence
Identical sequences ENSTTRP00000006304 ENSTTRP00000006304 XP_019779526.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]