SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006389 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006389
Domain Number 1 Region: 23-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.09e-46
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 252-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000114
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006389   Gene: ENSTTRG00000006755   Transcript: ENSTTRT00000006756
Sequence length 294
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_563:20691:53537:-1 gene:ENSTTRG00000006755 transcript:ENSTTRT00000006756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEPRGSNGSKPPRLGDSPDVRLLSNPLMGDTVSDWSPVHEAAIHGLLLFLRNFFSQGW
LVNLVTADRVSPLHEACLGGHPSCANILLKHGAQVNGVTTDWHTPLFNACVSGSLDCVNL
LLQHGASPHPESDLASPMHEAAKRGHVECIESLVAHGGDVDRNISHLGTPLYLACENLQV
ACAKKLLESGASVNQGRGLDSPLHAVARASSGELACLLMDFGADTQARDAEGHRPLELVP
PESPLSQLFLQREGPPSLMQLCRLRIWKCFGIKQHHKITGLSLPEELKWFLLHI
Download sequence
Identical sequences ENSTTRP00000006389 ENSTTRP00000006389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]