SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006494 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006494
Domain Number 1 Region: 101-164
Classification Level Classification E-value
Superfamily RILP dimerisation region 3.01e-17
Family RILP dimerisation region 0.0000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006494   Gene: ENSTTRG00000006868   Transcript: ENSTTRT00000006868
Sequence length 259
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3352:165504:167837:-1 gene:ENSTTRG00000006868 transcript:ENSTTRT00000006868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEQLQRLLLVNAELRHKLAAVQTQLRAARDRESESERRREATLEPAPEQAHGQAAAPGC
EQRQEPETAATGTGAPGTPEDRADALPPPGRPPKVGQCGFSREEVEQILQERNELKANVF
LLKEELAYFQRELLTDHRVPGLLLEAMKVAIRKQRRKIRPKMLGTPEEAESSDDEDGSWL
LLSRDKGDHLQPPPPESRIQSFLGLWCQGGTEAPEAEASIAATSEIRGGEEAPQQPPTPD
RPCSALDEYLHGVSAAPEA
Download sequence
Identical sequences ENSTTRP00000006494 ENSTTRP00000006494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]