SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006651 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000006651
Domain Number - Region: 25-88
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0549
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006651   Gene: ENSTTRG00000007035   Transcript: ENSTTRT00000007031
Sequence length 119
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2310:467:2332:-1 gene:ENSTTRG00000007035 transcript:ENSTTRT00000007031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKDKKPKKSTWKFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKSK
ITVASEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDGSESED
Download sequence
Identical sequences ENSTTRP00000006651 ENSTTRP00000006651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]