SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006684 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006684
Domain Number 1 Region: 414-528,648-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-64
Family Phosphate binding protein-like 0.00000000162
Further Details:      
 
Domain Number 2 Region: 22-402
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.23e-58
Family L-arabinose binding protein-like 0.0063
Further Details:      
 
Domain Number 3 Region: 545-647
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000196
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006684   Gene: ENSTTRG00000007042   Transcript: ENSTTRT00000007066
Sequence length 901
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1995:116334:609374:1 gene:ENSTTRG00000007042 transcript:ENSTTRT00000007066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVQIQELTGN
VQFDHYGRRVNYTMDVELKSTGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVTT
IMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKI
WNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
AKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGK
FAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVL
DKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDL
P
Download sequence
Identical sequences ENSTTRP00000006684 ENSTTRP00000006684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]