SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006893 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006893
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.66e-16
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 2-25
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000654
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006893   Gene: ENSTTRG00000007286   Transcript: ENSTTRT00000007285
Sequence length 109
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1596:9216:16452:-1 gene:ENSTTRG00000007286 transcript:ENSTTRT00000007285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Download sequence
Identical sequences ENSTTRP00000006893 ENSTTRP00000006893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]