SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006935 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006935
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-22
Family THAP domain 0.00000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006935   Gene: ENSTTRG00000007330   Transcript: ENSTTRT00000007329
Sequence length 227
Comment pep:known_by_projection scaffold:turTru1:scaffold_105573:372700:382432:1 gene:ENSTTRG00000007330 transcript:ENSTTRT00000007329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNCAAAGCATTYNKHINISFHRVPLDPKRRKEWVRLVRRKNFVPGKHTFLCSRHFEAS
CFDLTGQTRRLKMDAVPPIFDFCTHIKSMKLKSRNLLKKNNSCTPNGPPNLKSNISSQQV
LLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANN
ILLKGTSEHILPTALNSLPLEDFKILEQDQQGKTLPILLKQTKSTFN
Download sequence
Identical sequences ENSTTRP00000006935 ENSTTRP00000006935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]