SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006965 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006965
Domain Number 1 Region: 21-426
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.89e-34
Family L-arabinose binding protein-like 0.0074
Further Details:      
 
Domain Number 2 Region: 442-552,663-694
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.21e-31
Family Phosphate binding protein-like 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006965
Domain Number - Region: 570-656
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0153
Family Voltage-gated potassium channels 0.013
Further Details:      
 
Domain Number - Region: 779-812
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0217
Family Phosphate binding protein-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006965   Gene: ENSTTRG00000007360   Transcript: ENSTTRT00000007360
Sequence length 1008
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1981:69013:1079316:1 gene:ENSTTRG00000007360 transcript:ENSTTRT00000007360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLPLLLVLSFWWSRTLDSASADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGVTRSNRNDDYTLSVRPPVYLNDVILRVVTEYAWQKLIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
AFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWT
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTDIPYGTVLDSAVYEHVRMKGMNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHP
YRDVFSQRILELQQSGDMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILA
AGIVLSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSS
IDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFAFGNVPE
HRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Download sequence
Identical sequences ENSTTRP00000006965 ENSTTRP00000006965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]