SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007282 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007282
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-121
Family ALDH-like 0.0000000000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007282   Gene: ENSTTRG00000007697   Transcript: ENSTTRT00000007697
Sequence length 506
Comment pep:known_by_projection scaffold:turTru1:scaffold_102679:57647:70730:1 gene:ENSTTRG00000007697 transcript:ENSTTRT00000007697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREVQRVRAAFGSGRSRPLTFRRRQLEALRAMVQERERDILAAIAADLSKSEFNAYSQE
VITVLGEIELVLEKLPEWAAAKPAQKNLVTMLDEAYVQPEPLGVVLIIGAWNYPFVLTVQ
PLIGAIAAGNAVIIKPXXXXXXXXXXXXXXXXXXXXXDLYAVVNGGVEETTELLKQRFDH
ILYTGNTTVGKIVMEAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKYMNCGQT
CIAPDYVLCEPSLQDLIVRKVKEAVKEFYGENVKASPDYERIINLRHFKRIRGLLEGQKI
AFGGETDEATRYIAPTILTDVDPKTKVMQEEIFGPILPIVPVKNAEEAIQFINEREKPLA
FYVFSHNTKLIKQMIDRTSSGGVTGNDVIMHFMLSSLPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWAKLFFLKRLNRGKLGLLLLALLGVVVAALM
KKYQAVLRKALLIFLAVHRLCRPGSQ
Download sequence
Identical sequences ENSTTRP00000007282 ENSTTRP00000007282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]