SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007358 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007358
Domain Number 1 Region: 22-351
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.87e-129
Family Transferrin 0.000000000135
Further Details:      
 
Domain Number 2 Region: 361-698
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.49e-109
Family Transferrin 0.000000000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007358   Gene: ENSTTRG00000007776   Transcript: ENSTTRT00000007782
Sequence length 700
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_445:9189:40370:1 gene:ENSTTRG00000007776 transcript:ENSTTRT00000007782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAVCALLACAVLGLCLAVSEKTVRWCTVSSHEANKCSSFRENMNKVLADTGPFVSCVK
KTSYIDCIKAIMDNEADAVTLDGGLVFEAGLKPYNLKPAVAEYYGPKDKPQTQYYAVAVV
KKGTEFGLKELKGKKSCHTGLGRSAGWNIPMGLLYWDLPEPHESLQRAAASFFAGSCVPC
VDQSAFPKLCQLCAGKGTDKCACSNHEPYFGYSGAFKCLMEDAGEVAFVKHTTVFENLPN
EADRDEYELLCRDNTRGPVDEYERCHLARVPSHAVVARSMGGKEDLIWELLNQAQEHFGR
DTSESFQLFSSPHGKDLLFKDSANGFLKIPPKMDSWLYLGYEYVTALRNLREDTRPIASK
DECKKVKWCAVHHQEKVKCDMWSVSSDGEIECESADSTEECIAKITKGEADAMSLDGGYI
YIAGKCGLVPVLAENYKGQHCTTTLEDGYLAVAVVKKSDTDLNWNNLKGRKSCHTAVDRT
AGWNIPMGLLYNNINHCEFDKFFSEGCAPGSLRDSSLCALCIGSDRRECLPNNHERYYGY
SGAFRCLVEKGDVAFVKAQTVTENTGGNNPEEWAKTLQEEDFELLCTDGSRKPVKDAIDC
HLARAPNHAVVSREDKAACVRRILDKQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LAALPNATTYEYLGTEYVTAVANRQCSTSKLLEACSFHRP
Download sequence
Identical sequences ENSTTRP00000007358 ENSTTRP00000007358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]