SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007427 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007427
Domain Number 1 Region: 528-579,708-823
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.97e-35
Family Phosphate binding protein-like 0.00000206
Further Details:      
 
Domain Number 2 Region: 132-413
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.61e-23
Family L-arabinose binding protein-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007427   Gene: ENSTTRG00000007849   Transcript: ENSTTRT00000007852
Sequence length 1332
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_659:84070:114365:1 gene:ENSTTRG00000007849 transcript:ENSTTRT00000007852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGGPRGPRGPAKMLLLLALACASPFPEEVPGPGGAGGTGGEPGGARPLKVALVFSGP
EYATEAARLGPVEAAAARSPGLDRPVALVLNGSDSRSLVLQLCDMLSGLRVHGVVFEDDS
RAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEE
YDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLGAQLRSVSA
QIRLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGTPGEPLLLPGGAPLP
AGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLH
RYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGR
FLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFYQRADMAIGSLT
INEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXTGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLV
WAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKN
IRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSG
KVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLD
IDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEA
APPPAKPPPPPQPLPSPVYPAARPAPGPAPFIPRERATVDRWRRAKGAGPPGGASLADGF
HRYYGPIEPQGLGVGEARAAPRGATGRPLSPPATQPPQKPPPSYFAIVRDKEPAETPAGA
FPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPAPTRWPRSDPESQPLLGPGAGGAGGAG
GAGGGAQAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYAE
RLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPLHLSCSHDSLD
GGWWAPPPPPWAAGPPPHRARCGCPRSHPHRLRASHRAPAVVTPHHHRHRRAAGGWDLPP
PAPTSRSLEDISSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPAAPHRRHRGGDLSTRR
GSAHFSSLESEV
Download sequence
Identical sequences ENSTTRP00000007427 ENSTTRP00000007427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]