SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007445 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007445
Domain Number 1 Region: 171-357
Classification Level Classification E-value
Superfamily E set domains 5.13e-51
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000659
Further Details:      
 
Domain Number 2 Region: 69-187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-22
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007445   Gene: ENSTTRG00000007871   Transcript: ENSTTRT00000007871
Sequence length 420
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_659:128836:131923:1 gene:ENSTTRG00000007871 transcript:ENSTTRT00000007871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLARALRRLSGALESANNRAGDEEQAGPELCRNGWAPAQSQVGRRRGRFVKKDGHCNVR
FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAAPP
PTAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG
AVMAKMAKPKKRNETLIFSENAVVALRDRRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT
SEGEYIPLDHQDVDVGFDGGTDRLLRVSPITIGHEISASPYLAELRADFELVIRHVDTAM
TPQCRSYLLGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCSAKELDERAERA
SHSPKSGFPGSLAAFCYENELALSCCHEEEEEEEGDAAEAEDRAASPRVLTPTLALTLPP
Download sequence
Identical sequences ENSTTRP00000007445 ENSTTRP00000007445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]