SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007451 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007451
Domain Number 1 Region: 360-504
Classification Level Classification E-value
Superfamily CBS-domain pair 2.99e-17
Family CBS-domain pair 0.0068
Further Details:      
 
Domain Number 2 Region: 583-629,677-718
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000016
Family cAMP-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007451   Gene: ENSTTRG00000007877   Transcript: ENSTTRT00000007877
Sequence length 775
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3419:341363:375966:1 gene:ENSTTRG00000007877 transcript:ENSTTRT00000007877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVGGGGRPGGGPARGRLLLVAPVLLVLLWARGARGQGDPQRSAILGMRLASCNKSCGM
NSDGIIFVSEGSTVNLRLYGQRLGSLSSNLISFTEVDNAETIHNSTSCPELTKDLVVQKL
VNVSRGDTSGMLVVLTKFLRRSENMKLYALCTRAGVDGPWQKWTDKDSLLFMVEEAGRFL
PLWLHILLILVLLVLSGIFSGLNLGLMALDPMELSIVQNCGTQKERRYARKIEPIRRKGN
YLLCSLLLGNVLVNTSLTILVDNLIGSGLVAVAFSTIGIVIFGEIVPQALCSRHGLAVGA
NTIILTKFFMLLTFPLSFPISKLLDFFLGQEIRTVYNREKLMEMLKVTEPYNDLVKEELN
MIQGALELRTKTVEDIMTQLQDCFMIRNDAILDFNTMSEIMESGYTRIPVYEDEQSNIVD
ILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNN
EGEGDPFYEVLGLVTLEDVIEEIIKSEILDESDMYTDNRSRKRVSEKNKRDFSAFKDADN
ELKVKISPQLLLAAHRFLSTEVPQFSPSLISEKILLRLLKYPDVIQELKFDEHNKYYVRH
YLYTRNKPADYFILVLQGKVEVEAGKENMKFETGAFSYYGTMALSSSPSDRSPPHPAPLS
RSASLSYPDRSETASSTAPLAGSSQFGSSILGQYTSDFSVRALMDLQYIKITRQQYQNGL
LASRMENCPQFPPDGCTICTENLTDKSELPLVDETTTLLNECNSLLHRASLEGAI
Download sequence
Identical sequences ENSTTRP00000007451 XP_004314504.1.83887 XP_019786693.1.83887 ENSTTRP00000007451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]