SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007608 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007608
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007608   Gene: ENSTTRG00000008057   Transcript: ENSTTRT00000008041
Sequence length 306
Comment pep:known_by_projection scaffold:turTru1:scaffold_99153:7538:12622:1 gene:ENSTTRG00000008057 transcript:ENSTTRT00000008041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGVHSSGQVHAFGNCTDNDMLEEDAEVYELRSRGKEKIRRSTSKDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LYPPKGRQTSRPSSVQYLSEQQEVLSANDFLSSSESAGSFLKEVDRDIEQIVKCTDTKRE
NLNEVVSALTAQQVRFEPDNKNIQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSGVTPPSQQREMENEMAPTKGIPFVPQDDHKLYSQYSQLP
AARHKT
Download sequence
Identical sequences ENSTTRP00000007608 XP_004263587.1.21590 XP_004328880.1.83887 XP_019785269.1.83887 ENSTTRP00000007608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]