SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007759 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007759
Domain Number 1 Region: 862-996
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-19
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 610-725
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000785
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007759   Gene: ENSTTRG00000008188   Transcript: ENSTTRT00000008196
Sequence length 1164
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2864:130404:221051:-1 gene:ENSTTRG00000008188 transcript:ENSTTRT00000008196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYFDNIHNSQDLPDIILILSLICTIGAFLNLHLKDFPIPLPVILFLFGCSFEMFSFTS
DQVQNYADAVQWMDPHLFFDIFTPIILFNVAFDMDVYLLHKLFWQILLITIPGFLINYTL
ILWYLASVNKLVLKTTTWLLFSAILVSSDPMLTSSSIKDLGLSRGLVNLINGESLMTSIV
SLIVFTSIMDINFGLQKKVNYSLAHSIMDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXKLVGMSGIFTIVVMGLFLNSTSFKPGVEALLLEFWSCLSFVA
FLMVFTFIGLLIPAHTYLYISFSDIYYSLNICLTLVVFRLLVFLLLSPLLSRLGHGFSWR
WAFIMVWSEMKGIPNINMALLLAYSEYSLGSEREKSQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLHDVTSTKYKSLYYTFQHFQELTISVASALKFDKDLANADWNMVEKAIMLQNPYA
LGQEEKAEHQKVKCIHCNKEIDETLNIEAMELAKRRLLSAQIASYQRQYRNETLSQSAVQ
VLVGAAGSFGEKGEYMSAETIKNYSESKKILVFTRKVLLNWVYNTKKEKGIPSSHCFLRV
CHKIVFTDEFEYVGYLVILMNIFPIIISWISVLNDIYELELAYANYSFLAFYITEALLKI
AAMKKEYFLHAWNLFELTITLIGIIDVMLIETNSINYHTFDLIQTVAFIKVVRFLRVLRI
LKLVTPKLLQILDKKMSHQLSFKYAILKGYIQGEADIMTIIDKIASSKQIKQMLLRRITK
NTGHAMEELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEINKL
IMARKREILDLQPMYKPLTVDKALYHIPWLDKDQDCISFIQERSRVVTFDCGNDIFEEGD
EPQGIYVIISGMVKLQRSKPGLGIDQIIWESEEKDYQITYTDFVISGAIIGELNCLTNEP
MKYSATCKTVVEAYFIPKHHLYEAFEQFCPHIEYKMWLKLGLSITAKKIREHLSYEDWNY
KMQLKLCNVYVKNIPKNTKTDIYGETVIYVILIHGAVEDCQLRKAYKAPFLIPITCHQIQ
GTEDFTKVTIVRTAIDSKKFRWNTRKYITSRKRAHPVASAASRTNEEHPQEETSTQVNEA
HSAVTGRSPSSSCPITSLKKVNGQ
Download sequence
Identical sequences ENSTTRP00000007759 ENSTTRP00000007759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]