SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007794 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007794
Domain Number 1 Region: 85-154
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 7.59e-20
Family F1F0 ATP synthase subunit C 0.0045
Further Details:      
 
Domain Number 2 Region: 12-77
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000000575
Family F1F0 ATP synthase subunit C 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007794   Gene: ENSTTRG00000008231   Transcript: ENSTTRT00000008231
Sequence length 155
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1270:328472:335062:1 gene:ENSTTRG00000008231 transcript:ENSTTRT00000008231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV
MAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Download sequence
Identical sequences A0A2F0BIX8 D2HV78
ENSTTRP00000007794 ENSTTRP00000007794 XP_002926568.1.58354 XP_004270333.1.21590 XP_007100107.1.24612 XP_007181684.1.59432 XP_007453587.1.90284 XP_008694966.1.72690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]