SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007815 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007815
Domain Number 1 Region: 319-376
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 7-44
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000034
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00033
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000007815
Domain Number - Region: 277-319
Classification Level Classification E-value
Superfamily ARM repeat 0.00863
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007815   Gene: ENSTTRG00000008254   Transcript: ENSTTRT00000008253
Sequence length 376
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2435:9658:52545:-1 gene:ENSTTRG00000008254 transcript:ENSTTRT00000008253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSANTNTMPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAPQVIV
PDSKLIQHMNASNMXXXXXXXXXXXXXXVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQ
SVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQLTAAGQQQPQAQPAQQQAPLVLQVDGTGDTSSEEDEDEEEDYDDEEEEDKE
KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNL
NGRDYIFSKAIGDAEW
Download sequence
Identical sequences ENSTTRP00000007815 ENSTTRP00000007815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]