SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007828 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007828
Domain Number 1 Region: 359-592
Classification Level Classification E-value
Superfamily HCP-like 2.09e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 566-700
Classification Level Classification E-value
Superfamily HCP-like 9.02e-27
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 199-323
Classification Level Classification E-value
Superfamily HCP-like 1.13e-24
Family HCP-like 0.003
Further Details:      
 
Domain Number 4 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 4e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007828   Gene: ENSTTRG00000008263   Transcript: ENSTTRT00000008266
Sequence length 792
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2435:210865:263901:-1 gene:ENSTTRG00000008263 transcript:ENSTTRT00000008266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVWVGLTFLLCAVLLGSASASSDEEGNQDETLDSKTSLPSDESVEDHSPAGRVVAGQIF
LDSEESELESPIQEEEDGLRSQEGETVTEEISFLESANPENKDYEEPMKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLTQNIQ
AAKEMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
TAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
EATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGIVYFLQY
IRETNLRDLFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPVPRPGPRPAP
PQQGPPEQQPPQ
Download sequence
Identical sequences ENSTTRP00000007828 ENSTTRP00000007828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]