SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007883 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007883
Domain Number 1 Region: 409-523,672-748
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.08e-47
Family Phosphate binding protein-like 0.00000355
Further Details:      
 
Domain Number 2 Region: 76-324
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.51e-18
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007883   Gene: ENSTTRG00000008314   Transcript: ENSTTRT00000008321
Sequence length 968
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3049:133393:178484:-1 gene:ENSTTRG00000008314 transcript:ENSTTRT00000008321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAELLLLLIVAFASPSCQVLSSLRMAAILNNQTVCGRGERXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHVKV
GPEEMPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNIGFSMFNTSHPFYPEFVRSLNMSRENCEASTYPGPAL
SAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWSHGTSLMYLRXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXIGWYSNRTLAMNATTLDINLSQTLANKTLVVTTILEN
PYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMV
GELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPA
VWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQ
QGSEIMPRALSTRCVSGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTM
NEYHRRLNCNLTQIGGLLDTKGYGIGMPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPPLHPP
TLMLSPLAPLVTLDESTLLAKFSACALSAFPRTFLLFSPSLRHHQLFSFYWIKPGSIQMC
CHFSHLEPSLDPVSPPGHHPISPLVVALTVCPSAVSSFCPPIPSWTLPSSSCPHLSSEAN
LATSDLRI
Download sequence
Identical sequences ENSTTRP00000007883 ENSTTRP00000007883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]